The domain within your query sequence starts at position 84 and ends at position 276; the E-value for the MAM33 domain shown below is 1.2e-44.
LTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDG EEEPSQGQKAEEQEPELTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSI KEVSFQATGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQ EYITFLEDLKSFV
MAM33 |
---|
PFAM accession number: | PF02330 |
---|---|
Interpro abstract (IPR003428): | This mitochondrial matrix protein family contains members of the MAM33 family which bind to the globular 'heads' of C1Q.b. It is thought to be involved in mitochondrial oxidative phosphorylation and in nucleus-mitochondrion interactions [ (PUBMED:10097078) (PUBMED:9559539) ]. |
GO component: | mitochondrial matrix (GO:0005759) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MAM33