The domain within your query sequence starts at position 1 and ends at position 48; the E-value for the MBDa domain shown below is 2.4e-25.

XRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLSA

MBDa

 MBDa
PFAM accession number:PF16564
Interpro abstract (IPR032343):

This entry represents a second MBD domain of methyl-CpG-binding domain proteins 2 and 3. This region has been implicated in binding the RbAp46/48 (retinoblastoma protein-associated protein) homologue p55, which is one of the components of the MBD2-NuRD complex. The MBD2-NuRD complex is a nucleosome remodelling and deacetylation complex [ (PUBMED:21490301) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MBDa