The domain within your query sequence starts at position 49 and ends at position 216; the E-value for the MENTAL domain shown below is 2e-73.

SDVRRTFCLFVTFDLLFVTLLWIIELNVNGGIENTLKKEVIHYDYYSSYFDIFLLAVFRF
KVLILGYAVCRLRHWWAIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIET
WFLDFKVLPQEAEEENRLLLVQDASERAALIPAGLSDGQFYSPPESEA

MENTAL

MENTAL
PFAM accession number:PF10457
Interpro abstract (IPR019498):

The following proteins share a conserved region called the MENTAL (MLN64 N-terminal) domain, composed of four transmembrane helices with three short intervening loops [ (PUBMED:12393907) (PUBMED:15718238) (PUBMED:16709157) ]:

  • Animal MLN64 (metastatic lymph node 64), a late endosomal membrane protein containing a carboxyl-terminal cholesterol binding START domain ( IPR002913 ). It is probably involved in intracellular cholesterol transport.
  • Mammalian MENTHO (MLN64 N-terminal domain homologue), a late endosomal protein containing only the MENTAL domain. It is probably involved in cellular cholesterol homoeostasis.
The ~170-amino acid MENTAL domain mediates MLN64 and MENTHO homo- and hetero- interactions, targets both proteins to late endosomes and binds cholesterol. The MENTAL domain might serve to maintain cholesterol at the membrane of late endosomes prior to its shuttle to cytoplasmic acceptor(s) through the START domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MENTAL