The domain within your query sequence starts at position 13 and ends at position 163; the E-value for the MFS_1 domain shown below is 3.6e-12.

VFAVTVATIGSFQFGYNTGVINAPETILKDFLNYTLEERLEDLPSEGLLTALWSLCVAIF
SVGGMIGSFSVGLFVNRFGRRNSMLLVNLLAIIAGCLMGFAKIAESVEMLILGRLLIGIF
CGLCTGFVPMYIGEVSPTALRGAFGTLNQLG

MFS_1

MFS_1
PFAM accession number:PF07690
Interpro abstract (IPR011701):

Among the different families of transporter, only two occur ubiquitously in all classifications of organisms. These are the ATP-Binding Cassette (ABC) superfamily and the Major Facilitator Superfamily (MFS). The MFS transporters are single-polypeptide secondary carriers capable only of transporting small solutes in response to chemiosmotic ion gradients [ (PUBMED:9529885) (PUBMED:9868370) ].

The major facilitator superfamily (MFS) of membrane proteins represents the largest family of secondary transporters with members from Archaea to Homo sapiens. MFS proteins target a wide spectrum of substrates, including ions, carbohydrates, lipids, amino acids and peptides, nucleosides and other small molecules in both directions across the membrane, in many instances catalysing active transport by transducing the energy stored in an proton electrochemical gradient into a concentration gradient of substrate [ (PUBMED:23530251) ]. One remarkable characteristic of the MFS is the high sequence variety within the superfamily. The sequences identity ranges around 12-18% but regions of functional similarity (e.g., substrate- or H-binding sites) align for only very closely related MFS transporters. A hydrophobic amino acid content of 60-70% of most MFS members, high alfa-helix content and an inherent symmetry of the proteins with regard to helix kinks and bends provides nonspecific overlapping of residues and probably accounts for the reported similarities. MFS is subgrouped into 74 subfamilies based on phylogenetic analysis, postulated substrate specificity and expected transport mode (Madej M.G, Advances in Biology, Hindawi, Volume 2014, Article ID 523591:1-20).

GO process:transmembrane transport (GO:0055085)
GO function:transmembrane transporter activity (GO:0022857)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MFS_1