The domain within your query sequence starts at position 68 and ends at position 144; the E-value for the MFS_1_like domain shown below is 4.8e-19.
DLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVAD RFRKGKIVLLFSLLCWV
MFS_1_like |
---|
PFAM accession number: | PF12832 |
---|---|
Interpro abstract (IPR024989): | This domain is found in a number of major facilitator superfamily proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MFS_1_like