The domain within your query sequence starts at position 269 and ends at position 464; the E-value for the MFS_4 domain shown below is 4.3e-11.
SRRKLSPPKKVFNFALFKETTYAVWAAGIPLALFGYFVPYVHLMNHVKERFQDVNNKEVL FMCIGITSGVGRLLFGRIADYLPGVKKVYLQVLSFFFIGLMSMMIPLCSAFGALIAVCLA MGLFDGCFISIMAPIAFELVGPQDASQAIGFLLGFMSIPMTVGPPIAGLLHDKLGTYDVA FYLAGIPPFVGGVVLC
MFS_4 |
![]() |
---|
PFAM accession number: | PF06779 |
---|---|
Interpro abstract (IPR010645): | This entry represents a domain found in putative bacterial membrane proteins which may be sugar transporters. Members carry twelve transmembrane regions which are characteristic of members of the major facilitator sugar-transporter superfamily. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MFS_4