SMART: Pfam domain MHC_I

The domain within your query sequence starts at position 31 and ends at position 202; the E-value for the MHC_I_2 domain shown below is 1e-121.

DAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLT
QPLNDLCQELRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTF
YTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDEFLKQSKEK

MHC_I_2

PFAM accession number:	PF14586
Interpro abstract (IPR029287):	Members of this group are known as retinoic acid early inducible proteins (RAE-1) [ (PUBMED:8882725) (PUBMED:10894171) ]. They are ligands for the activating immunoreceptor NKG2D, which is widely expressed on natural killer cells, T cells, and macrophages [ (PUBMED:11825567) ]. There is a considerable diversity of NKG2D ligands. In mice, the ligands include, among others, five members of the retinoic acid early inducible gene 1 (RAE-1; alpha-epsilon) [ (PUBMED:14523385) ]. RAE-1 proteins are distant major histocompatibility complex (MHC) class I homologues, comprising isolated alpha1-alpha2 platform domains [ (PUBMED:11825567) ].

PFAM accession number:

PF14586

Interpro abstract (IPR029287):

Members of this group are known as retinoic acid early inducible proteins (RAE-1) [ (PUBMED:8882725) (PUBMED:10894171) ]. They are ligands for the activating immunoreceptor NKG2D, which is widely expressed on natural killer cells, T cells, and macrophages [ (PUBMED:11825567) ]. There is a considerable diversity of NKG2D ligands. In mice, the ligands include, among others, five members of the retinoic acid early inducible gene 1 (RAE-1; alpha-epsilon) [ (PUBMED:14523385) ].

RAE-1 proteins are distant major histocompatibility complex (MHC) class I homologues, comprising isolated alpha1-alpha2 platform domains [ (PUBMED:11825567) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MHC_I_2