The domain within your query sequence starts at position 31 and ends at position 202; the E-value for the MHC_I_2 domain shown below is 7.3e-112.
DAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLT QPLNDLCQELRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTF YTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDEFLKQSKEK
MHC_I_2 |
![]() |
---|
PFAM accession number: | PF14586 |
---|---|
Interpro abstract (IPR029287): | Members of this group are known as retinoic acid early inducible proteins (RAE-1) [ (PUBMED:8882725) (PUBMED:10894171) ]. They are ligands for the activating immunoreceptor NKG2D, which is widely expressed on natural killer cells, T cells, and macrophages [ (PUBMED:11825567) ]. There is a considerable diversity of NKG2D ligands. In mice, the ligands include, among others, five members of the retinoic acid early inducible gene 1 (RAE-1; alpha-epsilon) [ (PUBMED:14523385) ]. RAE-1 proteins are distant major histocompatibility complex (MHC) class I homologues, comprising isolated alpha1-alpha2 platform domains [ (PUBMED:11825567) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MHC_I_2