The domain within your query sequence starts at position 681 and ends at position 775; the E-value for the MLIP domain shown below is 6.5e-53.
VEHSSDSPSRPPQTMLGSETIKTPTTHPRAAGRETKYANLSSSSSTASESQLTKPGVIRP VPVKSKLLLRKDEEVYEPNPFSKYLEDNSGLFSEQ
MLIP |
![]() |
---|
PFAM accession number: | PF15274 |
---|---|
Interpro abstract (IPR029331): | Muscular LMNA-interacting protein (MLIP) is a muscle-enriched A-type Lamin-interacting protein, an innovation of amniotes, and is expressed ubiquitously and most abundantly in heart, skeletal, and smooth muscle. MLIP interacts directly and co-localises with lamin A and C in the nuclear envelope. MLIP also co-localises with promyelocytic leukemia (PML) bodies within the nucleus. PML, like MLIP, is only found in amniotes, suggesting that a functional link between the nuclear envelope and PML bodies may exist through MLIP [ (PUBMED:21498514) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MLIP