The domain within your query sequence starts at position 435 and ends at position 635; the E-value for the MMPL domain shown below is 9.7e-8.

LLKYYLAEDTMYPLIALVVIFFGMSLYLRSLFITFMSLLGVLGSLMVAYFLYHVAFRMAY
FPFVNLAALLLLSGVCVNYTLIFLDMWRLSRGQVPSGGMPHRVGRTMHHFGYLLLVSGLT
TSAAFYGSYLSRLPAVRCFALFMGTAVLVHMGLTLLWLPATVVLHERYLAHGCVAQAHGQ
RGGSDPLRLLLALHRRIRIFR

MMPL

 MMPL
PFAM accession number:PF03176
Interpro abstract (IPR004869):

This entry represents a domain found in the MmpL family of membrane transport proteins. Many of the proteins contain two copies of this aligned region. Some members have been characterised, for instance, Mycobacterium tuberculosis MMPL10 is required for the biosynthesis of polyacyltrehalose (PAT) and the transport of diacyltrehalose (DAT) and possibly PAT to the cell surface [ (PUBMED:25124040) ], while MMPL4 is a part of an export system required for biosynthesis and secretion of siderophores [ (PUBMED:23431276) ].

GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMPL