The domain within your query sequence starts at position 146 and ends at position 293; the E-value for the MMR_HSR1 domain shown below is 7.3e-7.
TLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLT IVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGH GLRPLDVEFMKALHQRVNIVPILAKADT
MMR_HSR1 |
![]() |
---|
PFAM accession number: | PF01926 |
---|---|
Interpro abstract (IPR006073): | Several proteins have recently been shown to contain the 5 structural motifs characteristic of GTP-binding proteins [ (PUBMED:1449490) ]. These include murine DRG protein; GTP1 protein from Schizosaccharomyces pombe; OBG protein from Bacillus subtilis [ (PUBMED:12429099) ]; ferrous iron transport protein B [ (PUBMED:20123128) ] and several others. |
GO function: | GTP binding (GO:0005525) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMR_HSR1