The domain within your query sequence starts at position 186 and ends at position 291; the E-value for the MMR_HSR1_Xtn domain shown below is 1.7e-48.
KGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIY VLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKL
MMR_HSR1_Xtn |
---|
PFAM accession number: | PF16897 |
---|---|
Interpro abstract (IPR031662): | This entry represents a domain C-terminal to IPR006073 in a group of GTP binding proteins. Its function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMR_HSR1_Xtn