SMART: Pfam domain MMS22L

The domain within your query sequence starts at position 578 and ends at position 733; the E-value for the MMS22L_C domain shown below is 1.9e-58.

EQLAEMTRLLFTLSEVKSVFSKAQIEQLPSPDDPKQALIQFLEAVGVTYRTLQTFSDKSA
MVTKSLEYLGEVLKYIKPYLGKKVSSAGLQLTYGIMGILVKSWAHIFATSKAQKLLFRII
DCLLLPHTVLQQDKELPGPMLTAIQKTLPLYLQEIL

MMS22L_C

PFAM accession number:	PF14911
Interpro abstract (IPR029424):	This entry represents the C-terminal of the MMS22L (Methyl methanesulfonate-sensitivity protein 22-like) protein. MMS22L is a component of the MMS22L-TONSL complex, a complex that stimulates the recombination-dependent repair of stalled or collapsed replication forks [ (PUBMED:21055983) ]. The MMS22L-TONSL complex is required to maintain genome integrity during DNA replication by promoting homologous recombination-mediated repair of replication fork-associated double-strand breaks [ (PUBMED:21055984) (PUBMED:21055985) ]. It may act by mediating the assembly of RAD51 filaments on ssDNA [ (PUBMED:21055985) ].

PFAM accession number:

PF14911

Interpro abstract (IPR029424):

This entry represents the C-terminal of the MMS22L (Methyl methanesulfonate-sensitivity protein 22-like) protein.

MMS22L is a component of the MMS22L-TONSL complex, a complex that stimulates the recombination-dependent repair of stalled or collapsed replication forks [ (PUBMED:21055983) ]. The MMS22L-TONSL complex is required to maintain genome integrity during DNA replication by promoting homologous recombination-mediated repair of replication fork-associated double-strand breaks [ (PUBMED:21055984) (PUBMED:21055985) ]. It may act by mediating the assembly of RAD51 filaments on ssDNA [ (PUBMED:21055985) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMS22L_C