The domain within your query sequence starts at position 115 and ends at position 159; the E-value for the MOR2-PAG1_N domain shown below is 3.3e-7.

ERRDLAIDFIFSLVLIEVLKQIPLHPVIDSLIHDIINLAFKHFKY

MOR2-PAG1_N

MOR2-PAG1_N
PFAM accession number:PF14222
Interpro abstract (IPR025614):

This entry represents the conserved N-terminal domain of proteins that are involved in cell morphogenesis. Among these are furry proteins and homologues [ (PUBMED:11526084) (PUBMED:16061630) ], and proteins PAG1 [ (PUBMED:11854408) ] and Mor2 [ (PUBMED:12234926) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOR2-PAG1_N