The domain within your query sequence starts at position 19 and ends at position 65; the E-value for the MOZART1 domain shown below is 4.1e-28.
RETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELR
MOZART1 |
---|
PFAM accession number: | PF12554 |
---|---|
Interpro abstract (IPR022214): | MOZART1 or Mzt1 is a component of the gamma-tubulin complex and is required for its recruitment to the microtubule organizing centre in humans and yeast [ (PUBMED:20360068) (PUBMED:24006493) (PUBMED:23885124) ]. This function is conserved in plant homologues, known as gamma-tubulin complex protein 3 (GCP3)-interacting proteins (GIPs) [ (PUBMED:18178112) (PUBMED:22404201) ]. Studies in plant homologues GIP1 and GIP2 indicate that they play a major role in nuclear envelope shaping in both cycling and differentiated cells [ (PUBMED:24570680) ] and that they are essential for centromere architecture [ (PUBMED:26124146) (PUBMED:26517054) ]. |
GO process: | gamma-tubulin complex localization (GO:0033566) |
GO component: | gamma-tubulin ring complex (GO:0008274) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOZART1