The domain within your query sequence starts at position 11 and ends at position 98; the E-value for the MOZART2 domain shown below is 4.5e-44.

AALAVSTGLETATLQKLALRRKKVLGAEEMELYELAQAAGAAIDPDVFKILVDLLNLNVA
PLAVFQMLKSMCAGQRLASDPQDSVPIS

MOZART2

MOZART2
PFAM accession number:PF12926
Interpro abstract (IPR024332):

The MOZART2 family of proteins (also known as FAM128 and Mitotic-spindle organizing protein 2) operate as part of the gamma-tubulin ring complex, gamma-TuRC, one of the complexes necessary for chromosome segregation. This complex is located at centrosomes and mediates the formation of bipolar spindles in mitosis; it consists of six subunits. However, unlike the other four known subunits, the MOZART proteins, both 1 and 2, do not carry the conserved 'Spc97-Spc98' GCP domain, so the TUBGCP nomenclature cannot be used for it. The exact function of MOZART2 is not clear [ (PUBMED:20360068) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOZART2