The domain within your query sequence starts at position 31 and ends at position 170; the E-value for the MPLKIP domain shown below is 8.9e-27.
LGGGPRPPSLWDCYRSPHHTPPCGPRARPYGSRQSQQHSSNFSGVRFASPSPGGYPGSYS RSPAGSQHQFGYSPGQQQTYPQGSPRTSTPFGSGRGREKRMSNELESYFKPSMLEDPWAG LEPVSVVDISQQYSNTQTFT
MPLKIP |
---|
PFAM accession number: | PF15502 |
---|---|
Interpro abstract (IPR028265): | This entry includes animal M-phase-specific PLK1-interacting protein (also known as TTDN1) and plant protein SICKLE. M-phase-specific PLK1-interacting protein (also known as TTD non-photosensitive 1 protein, TTDN1) co-localises with Plk1 at the centrosome in mitosis and the midbody during cytokinesis [ (PUBMED:17310276) ]. TTDN1 is phosphorylated by cyclin-dependent kinase 1 during mitosis and subsequently interacts with polo-like kinase 1 (PLK1) [ (PUBMED:17310276) (PUBMED:15645389) ]. It may play a role in maintenance of cell cycle integrity by regulating mitosis or cytokinesis [ (PUBMED:17310276) ]. Mutations in the C7orf11 (TTDN1) gene has been linked to Trichothiodystrophy (TTD), a rare autosomal recessive disorder whose defining feature is brittle hair [ (PUBMED:16977596) ]. Protein SICKLE is required for development and abiotic stress tolerance, and is involved in microRNA biogenesis [ (PUBMED:23071326) ] and mRNA splicing [ (PUBMED:27624757) ]. SICKLE, also known as ROTUNDA 3, may contribute to plant development by phosphatase 2A-mediated regulation of auxin transporter recycling [ (PUBMED:26888284) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MPLKIP