The domain within your query sequence starts at position 44 and ends at position 192; the E-value for the MREG domain shown below is 5.2e-74.

LERDDEKNLWSMPHDVSHTEADDDRILYNLIVIRNQQTKDSEEWQRLNYDIYTLRQIRRE
VRNRWRRILEDLGFQREADSLLSVTKLSTMSDSKNTRKAREMLLKLAEETSIFPASWELS
ERYLLVVDRLIALDAAEDFFKIASQMYPK

MREG

 MREG
PFAM accession number:PF15812
Interpro abstract (IPR031638):

Melanoregulin (MREG) is a putative membrane fusion regulator that forms a complex with peripherin-2 [ (PUBMED:17260955) ]. It is required for lysosome maturation and plays a role in intracellular trafficking [ (PUBMED:19240024) ]. Melanoregulin is involved in the retrograde melanosome transport in melanocytes, which is dependent on the dynein-dynactin motor complex [ (PUBMED:22275436) ], and is a negative regulator of melanosome intercellular transfer [ (PUBMED:22753477) ]. Palmitoylation serves to stably anchor melanoregulin in the melanosome membrane [ (PUBMED:22940130) ].

GO process:melanosome transport (GO:0032402)
GO component:melanosome (GO:0042470)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MREG