SMART: Pfam domain MRF

The domain within your query sequence starts at position 525 and ends at position 560; the E-value for the MRF_C1 domain shown below is 1.8e-24.

LMVDKDQIFMENVGAVKQLCKLTNNLEERIEELEIW

MRF_C1

PFAM accession number:	PF13887
Interpro abstract (IPR026932):	Myelin gene regulatory factor is a transcription regulator required in vertebrates for expression of central nervous system (CNS) myelin genes such as Mbp and Mog, thereby playing a central role in oligodendrocyte maturation and CNS myelination [ (PUBMED:19596243) ]. It is also required for the maintenance of expression of myelin genes and the mature oligodendrocytes identity in the adult CNS [ (PUBMED:22956843) ]. A Caenorhabditis elegans orthologue, pqn-47, may function as a regulator of molting [ (PUBMED:21989027) ], while a Dictyostelium orthologue has been described to regulate prestalk differentiation [ (PUBMED:22811266) ]. This domain is found towards the C terminus of myelin gene regulatory factor. The function of this domain is not known.

PFAM accession number:

PF13887

Interpro abstract (IPR026932):

Myelin gene regulatory factor is a transcription regulator required in vertebrates for expression of central nervous system (CNS) myelin genes such as Mbp and Mog, thereby playing a central role in oligodendrocyte maturation and CNS myelination [ (PUBMED:19596243) ]. It is also required for the maintenance of expression of myelin genes and the mature oligodendrocytes identity in the adult CNS [ (PUBMED:22956843) ]. A Caenorhabditis elegans orthologue, pqn-47, may function as a regulator of molting [ (PUBMED:21989027) ], while a Dictyostelium orthologue has been described to regulate prestalk differentiation [ (PUBMED:22811266) ].

This domain is found towards the C terminus of myelin gene regulatory factor. The function of this domain is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRF_C1