The domain within your query sequence starts at position 1 and ends at position 114; the E-value for the MRP-S23 domain shown below is 1.7e-38.
MRAGVLKEKPLWYDIYKAFPPLREPVFRRPRLRYGKAKADIQDIFYQEDQIRAKFFATYG SGQKAFDLFNPNFKSTCQRFVEKYTELQNLGETDEEKLFVETGKALLAEGIILR
MRP-S23 |
 |
|---|
| PFAM accession number: | PF10484 |
|---|---|
| Interpro abstract (IPR023611): | This entry represents a domain found in both the mitochondrial ribosomal 23S and 25S proteins. The function of this conserved region is not known. In Saccharomyces cerevisiae (Baker's yeast) the mature mitochondrial ribosomes consist of a small (37S) and a large (54S) subunit. The 37S subunit contains at least 33 different proteins and 1 molecule of RNA (15S). The 54S subunit contains at least 45 different proteins and 1 molecule of RNA (21S) [ (PUBMED:11278769) (PUBMED:16823961) ]. |
| GO process: | translation (GO:0006412) |
| GO component: | ribosome (GO:0005840) |
| GO function: | structural constituent of ribosome (GO:0003735) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-S23