The domain within your query sequence starts at position 36 and ends at position 167; the E-value for the MRP-S24 domain shown below is 1.1e-61.
KNRAARVRVAKGNKPVSYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTLEDVFLRKF MMGTFPGCLADQIVLKRRANQVDICALVLRQLPAHKFYFLVGYSETLLSHFYKCPVRLHL QTVPSKVVYKYI
MRP-S24 |
![]() |
---|
PFAM accession number: | PF14955 |
---|---|
Interpro abstract (IPR026146): | Members of this family are mitochondrial ribosomal subunit S24 from eukaryotes [ (PUBMED:10938081) (PUBMED:11402041) ]. |
GO component: | mitochondrion (GO:0005739) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-S24