The domain within your query sequence starts at position 136 and ends at position 229; the E-value for the Mab-21 domain shown below is 6.8e-16.
YYEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSA TKMLSKFRKIIKEEVKEIKEKMDQPFLCFTVCKQ
Mab-21 |
 |
|---|
| PFAM accession number: | PF03281 |
|---|---|
| Interpro abstract (IPR024810): | This domain is present in Mab-21 and Mab-21 like proteins. In Caenorhabditis elegans these proteins are required for several aspects of embryonic development [ (PUBMED:8582275) (PUBMED:15385160) ]. This entry also includes inositol 1,4,5-triphosphate receptor-interacting proteins, which are predicted to contain a partial Mab-21 domain [ (PUBMED:16990268) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mab-21