The domain within your query sequence starts at position 2 and ends at position 78; the E-value for the Macoilin domain shown below is 7e-48.
KRRNADCSKLRRPLKRNRITEGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLF IRSVYDSFRYQGLLHLT
Macoilin |
---|
PFAM accession number: | PF09726 |
---|---|
Interpro abstract (IPR019130): | Macoilin has several highly conserved predicted transmembrane domains towards the N terminus and the coiled-coil regions at the C terminus. It is a conserved nervous system-specific ER membrane protein that regulates neuronal functions [ (PUBMED:21437263) (PUBMED:21589894) ]. |
GO process: | neuronal signal transduction (GO:0023041) |
GO component: | rough endoplasmic reticulum membrane (GO:0030867) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Macoilin