The domain within your query sequence starts at position 128 and ends at position 329; the E-value for the Maelstrom domain shown below is 1.6e-58.
PHCEQRFLPCEIGCVKYSLQEGIMADFHSFIHPGEIPRGFRFHCQAASDSSHKIPISNFE FGHDQATVLQNLYKFIHPNPGNWPPIYCKSDDRARVNWCLKRMERASEIRQDLELLTVED LVVGIYQQKFLKEPSKTWVRSLLDVAMWDYSSNTRCKWHEENDILFCALAVCKKIAYCIS NSLATLFGIQLTGAHVPLQDYE
Maelstrom |
---|
PFAM accession number: | PF13017 |
---|---|
Interpro abstract (IPR024970): | Maelstrom is a germ-plasm component protein that is involved in the piRNA pathway, though its precise function is not known. This protein contains a novel domain, known as the Maelstrom domain, which adopts the RNaseH fold. Maelstrom is essential for Piwi-mediated silencing and acts downstream of or in parallel to H3K9me3 in Drosophila [ (PUBMED:23159368) ]. |
GO process: | regulation of gene silencing by miRNA (GO:0060964) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Maelstrom