The domain within your query sequence starts at position 84 and ends at position 202; the E-value for the Maf1 domain shown below is 4.3e-37.
LSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLRWVVNAVNCSLFSAVRED
Maf1 |
![]() |
---|
PFAM accession number: | PF09174 |
---|---|
Interpro abstract (IPR015257): | Maf1 is a negative regulator of RNA polymerase III [ (PUBMED:11438659) (PUBMED:16762835) ]. It inhibits the de novo assembly of TFIIIB onto DNA [ (PUBMED:17785443) ]. Maf1 represses Pol III in response to DNA damage, oxidative stress, growth to stationary phase, treatment with rapamycin or chlorpromazine, and blocking of the secretory pathway [ (PUBMED:15196897) ]. It targets the initiation factor TFIIIB [ (PUBMED:12504022) ]. Its structure has been solved [ (PUBMED:20887893) ]. |
GO process: | negative regulation of transcription by RNA polymerase III (GO:0016480) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Maf1