The domain within your query sequence starts at position 1964 and ends at position 2000; the E-value for the Med12-PQL domain shown below is 1.1e-18.
PADPTRHLQQRPSGYVHQQAPTYGHGLTSTQRFSHQT
Med12-PQL |
---|
PFAM accession number: | PF12144 |
---|---|
Interpro abstract (IPR021989): | This domain is found in eukaryotes, and is typically between 325 and 354 amino acids in length. It is found in the C-terminal region of the mediator of RNA polymerase II transcription subunit 12. Both development and carcinogenesis are driven by signal transduction within the canonical Wnt/beta-catenin pathway through both programmed and unprogrammed changes in gene transcription. Beta-catenin physically and functionally targets this PQL (proline-, glutamine-, leucine-rich) region of the Med12 subunit of Mediator to activate transcription. The beta-catenin transactivation domain binds directly to isolated Med12 and intact Mediator both in vitro and in vivo, and Mediator is recruited to Wnt-responsive genes in a beta-catenin-dependent manner. |
GO component: | mediator complex (GO:0016592) |
GO function: | beta-catenin binding (GO:0008013) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med12-PQL