SMART: Pfam domain Med13

The domain within your query sequence starts at position 1 and ends at position 384; the E-value for the Med13_N domain shown below is 5e-130.

MSSSFVSNGASLEDCHCNLFCLADLTGIKWKRYVWQGPTSAPILFPVTEEDPILSSFSRC
LKADVLGVWRRDQRPGRRELWIFWWGKDPNFADLIHHDLSEEEDGVWENGLSYECRTLLF
KAVHNLLERCLMNRNFVRIGKWFVKPYEKDEKPINKSEHLSCSFTFFLHGDSNVCTSVEI
NQHQPVYLLSEEHVTLAQQSNSPFQVILSPFGLNGTLTGQAFKMSDSATKKLIGEWKQFY
PISCGLKEMSEEKQDDMDWEDDSLAAVEVLVAGVRMIYPACFVLVPQSDIPAPSSVGASH
CSASCLGIHQVPASTRDPAMSSVTLTPPTSPEEVQTVDPQSAQKWVKFSSVSDGFSTDST
SHHGGKIPRKLANHVVDRVWQECN

Med13_N

PFAM accession number:	PF11597
Interpro abstract (IPR021643):	This entry represents the N-terminal domain of Med13. Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [ (PUBMED:12738880) (PUBMED:15175151) ]. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Med13 is part of the ancillary kinase module, together with Med12, CDK8 and CycC, which in yeast is implicated in transcriptional repression, though most of this activity is likely attributable to the CDK8 kinase. The large Med12 and Med13 proteins are required for specific developmental processes in Drosophila [ (PUBMED:17290221) ], zebrafish, and Caenorhabditis elegans but their biochemical functions are not understood [ (PUBMED:18451032) ].

PFAM accession number:

PF11597

Interpro abstract (IPR021643):

This entry represents the N-terminal domain of Med13.

Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [ (PUBMED:12738880) (PUBMED:15175151) ]. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Med13 is part of the ancillary kinase module, together with Med12, CDK8 and CycC, which in yeast is implicated in transcriptional repression, though most of this activity is likely attributable to the CDK8 kinase. The large Med12 and Med13 proteins are required for specific developmental processes in Drosophila [ (PUBMED:17290221) ], zebrafish, and Caenorhabditis elegans but their biochemical functions are not understood [ (PUBMED:18451032) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med13_N