The domain within your query sequence starts at position 3 and ends at position 58; the E-value for the Med23 domain shown below is 1.2e-10.
PMETQLQSIFEEVVKTEIIEEAFPGMFMDTPEDEKTKLISCLAAFRQFWSGLSQIV
Med23 |
![]() |
---|
PFAM accession number: | PF11573 |
---|---|
Interpro abstract (IPR021629): | Med23 is one of the subunits of the Tail portion of the Mediator complex that regulates RNA polymerase II activity. Med23 is required for heat-shock-specific gene expression, and has been shown to mediate transcriptional activation of E1A in mice. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med23