The domain within your query sequence starts at position 51 and ends at position 184; the E-value for the Met_10 domain shown below is 1.2e-7.
YECYSDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTGILSIFCAQAGARR VYAVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELPERVDAIVSEWMGYGLLHESML SSVLHARTKWLKEG
Met_10 |
![]() |
---|
PFAM accession number: | PF02475 |
---|---|
Interpro abstract (IPR030382): | This entry represents a domain found in the Trm5/Tyw2-type methyltransferase. Trm5 and Tyw2 are S-adenosylmethionine-dependent methyltransferases involved in tRNA methylation [ (PUBMED:20382657) ]. Wybutosine synthesis is a multienzymatic process that comprises six sequential enzymatic reactions involving five enzymes. The initial step, the formation of m1G-37 (guanosine-37 methylated in the N1 position) in precursor tRNAPhe is catalysed by tRNA wybutosine-synthesising protein 5 (Trm5). Tyw2 catalyses the second step, consisting of the alpha-amino-alpha-carboxypropyl (acp) group being transferred from S-AdoMet to the side chain at the C7 position of 4-demethylwyosine (imG-14) to produce wybutosine-86 [ (PUBMED:16642040) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Met_10