The domain within your query sequence starts at position 1 and ends at position 143; the E-value for the Metallophos_2 domain shown below is 1.1e-23.
MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVR GDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFE AFEHENKFYINPGSATGAYNALE
Metallophos_2 |
![]() |
---|
PFAM accession number: | PF12850 |
---|---|
Interpro abstract (IPR024654): | This calcineurin-like phosphoesterase domain can be found in some of the bacterial UDP-2,3-diacylglucosamine hydrolases (lpxH), archaeal DNA double-strand break repair protein Mre11 and the N-terminal of the nuclease SbcCD subunit D from bacteria. It can also be found in the eukaryotic vacuolar protein sorting-associated protein 29 (VPS29). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Metallophos_2