The domain within your query sequence starts at position 268 and ends at position 359; the E-value for the Methyltr_RsmF_N domain shown below is 2.9e-12.
FLLSKLMELFPLSELIEFLEANEVPRPITLRTNTLKTRRRDLAQALINRGVNLDPLGKWS KSGLVVYDSSVPIGATPEYLAGHYMLQGASSM
Methyltr_RsmF_N |
---|
PFAM accession number: | PF17125 |
---|---|
Interpro abstract (IPR031341): | This is the N-terminal domain of the RsmF methyl transferase. RsmF is a multi-site-specific methyltransferase that is responsible for the synthesis of three modifications on cytidines in 16S ribosomal RNA. The N terminus is critical for stabilising the catalytic core of the enzyme [ (PUBMED:16793063) (PUBMED:20558545) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltr_RsmF_N