The domain within your query sequence starts at position 276 and ends at position 331; the E-value for the Methyltransf_10 domain shown below is 5.5e-21.

FRIIISFRWYSCMLGKKCSLAPLKEELRIQGVPKVTFTEFCQGRTMRWALAWSFYD

Methyltransf_10

• PFAM accession number: PF05971
• Interpro abstract (IPR010286):

  This family includes ribosomal RNA large subunit methyltransferase F (RlmF), and related proteins, including methyltransferase-like protein 16 (METTL16). METTL16 is a conserved RNA methyltransferase which interacts specifically with the MALAT1 triple helix. METTL16 shows nuclear localisation [ (PUBMED:27872311) ]. Another functional study indicates that METTL16 regulates expression of human MAT2A, which encodes the SAM synthetase expressed in most cells. Furthermore, results indicate that METTL16 is the long-unknown methyltransferase for the U6 spliceosomal small nuclear RNA (snRNA) and it has evolved an additional function in vertebrates to control SAM homeostasis by post-transcriptionally regulating SAM synthetase gene expression [ (PUBMED:28525753) ].

  RlmF methylates the adenine in position 1618 of 23S rRNA [ (PUBMED:18021804) ]. This family also includes psilocybin synthase (PsiM), which is a methyltransferase involved in the biosynthesis of the psychotropic agent psilocybin from the mushroom Psilocybe cubensis [ (PUBMED:28763571) ].

• GO function: methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_10