The domain within your query sequence starts at position 71 and ends at position 176; the E-value for the Methyltransf_18 domain shown below is 1.6e-9.

KLTLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLFKSVAENRQLQFERFVVAVGEDM
HQVTDGSVDVVVCTLVLCSVKNQEKILREVCRVLKPGGAFYFIDHV

Methyltransf_18

Methyltransf_18
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_18