SMART: Pfam domain Methyltransf

The domain within your query sequence starts at position 131 and ends at position 328; the E-value for the Methyltransf_21 domain shown below is 3.8e-8.

YISTTQIACDHMGTDSLATDSSPAPKPWLVCLDDRFGLAHQIRSKRCRLYSLGLGSDDTH
FEVSMANGGCEVHRFDPSVKSAHVLERQGLWHHRLSIDWRDPHPAVAAQKPHGNTRKLGS
ILNEFGHHKIDVLKADLESAEWKVLENLILEDVLEQIGQLVFEIHLHWPGFEVSGSESGV
VRFWYSLLKELERKHFRL

Methyltransf_21

PFAM accession number:	PF05050
Interpro abstract (IPR006342):	This domain is characterised by two well-conserved short regions separated by a variable region in both sequence and length. The first of the two regions is found in a large number of proteins outside this group, a number of which have been characterised as methyltransferases. One member of this group, FkbM, was shown to be required for a specific methylation in the biosynthesis of the immunosuppressant FK506 in Streptomyces strain MA6548 [ (PUBMED:8752344) ].

PFAM accession number:

PF05050

Interpro abstract (IPR006342):

This domain is characterised by two well-conserved short regions separated by a variable region in both sequence and length. The first of the two regions is found in a large number of proteins outside this group, a number of which have been characterised as methyltransferases. One member of this group, FkbM, was shown to be required for a specific methylation in the biosynthesis of the immunosuppressant FK506 in Streptomyces strain MA6548 [ (PUBMED:8752344) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_21