The domain within your query sequence starts at position 65 and ends at position 161; the E-value for the Methyltransf_25 domain shown below is 2.4e-8.
ALDCGAGIGRITKRLLLPLFRVVDMVDVTEDFLAKAKTYLGEEGKRVRNYFCCGLQDFSP EPGSYDVIWIQWVIGHLTDQHLAEFLRRCKRGLRPNG
Methyltransf_25 |
 |
|---|
| PFAM accession number: | PF13649 |
|---|---|
| Interpro abstract (IPR041698): | This is a methyltransferase domain is a member of a Pfam clan that includes Rossmann-fold domains. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_25