SMART: Pfam domain Methyltransf

The domain within your query sequence starts at position 57 and ends at position 218; the E-value for the Methyltransf_9 domain shown below is 2.6e-8.

VSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEA
SAIWQQAREVVRLNGLEDRVHVLPGPVETVELPERVDAIVSEWMGYGLLHESMLSSVLHA
RTKWLKEGGLLLPASAELFVAPISDQMLEWRLGFWSQVKQHY

Methyltransf_9

PFAM accession number:	PF08003
Interpro abstract (IPR027555):	Proteins in this entry include bacterial tRNA U34 carboxymethyltransferases and some methyltransferases from soil and rhizosphere bacteria. tRNA U34 carboxymethyltransferase ComB catalyses the conversion of 5-hydroxyuridine (ho5U) to uridine-5-oxyacetic acid (cmo5U) at the wobble position (34) of tRNA [ (PUBMED:15383682) (PUBMED:23676670) ]. cmo5U is a modified nucleoside that is apparently necessary for the efficient decoding of G-ending Pro, Ala, and Val codons in these organisms [ (PUBMED:17942742) ].

PFAM accession number:

PF08003

Interpro abstract (IPR027555):

Proteins in this entry include bacterial tRNA U34 carboxymethyltransferases and some methyltransferases from soil and rhizosphere bacteria. tRNA U34 carboxymethyltransferase ComB catalyses the conversion of 5-hydroxyuridine (ho5U) to uridine-5-oxyacetic acid (cmo5U) at the wobble position (34) of tRNA [ (PUBMED:15383682) (PUBMED:23676670) ]. cmo5U is a modified nucleoside that is apparently necessary for the efficient decoding of G-ending Pro, Ala, and Val codons in these organisms [ (PUBMED:17942742) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_9