The domain within your query sequence starts at position 64 and ends at position 278; the E-value for the Methyltransf_PK domain shown below is 5.7e-74.
GEMQFYARAKLFYQEVPATEEGMMGNFIELSNPDIQASREFLRKFVGGPGRAGTGCALDC GSGIGRVSKHVLLPVFSSVELVDMMESFLLEAQSYLQVNEDKVESYHCYSLQEFTPHLGR YDVIWIQWVSGYLTDKDLLAFLSRCRDGLKENGVIILKDNVAREGCIFDLSDSSVTRDMD ILRSLIRKSGLVVLGQEKQEGFPEQCVPVWMFALH
Methyltransf_PK |
![]() |
---|
PFAM accession number: | PF05891 |
---|---|
Interpro abstract (IPR008576): | All fungal and animal N-terminally methylated proteins contain a unique N-terminal motif, Met-(Ala/Pro/Ser)-Pro-Lys. Alpha-N-methyltransferase methylates the N terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. It catalyses mono-, di- or tri-methylation of the exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif [ (PUBMED:20481588) ]. |
GO process: | N-terminal protein amino acid methylation (GO:0006480) |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_PK