The domain within your query sequence starts at position 475 and ends at position 632; the E-value for the Mic1 domain shown below is 4.4e-73.
PHKFVIAVLMEYIRSLNQFQIPVQHYLHELVIKTLVQHNLFYMLHQFLQYHVLSDSKPLA CLLLSLESFYPPAHQLSLDMLKRLSTANDEIVEVLLSKHQVLAALRFIRGIGGHDNISAR KFLDAARQTDDVMLFYTIFRFFEQRNQRLRGNPNFTPG
Mic1 |
![]() |
---|
PFAM accession number: | PF07035 |
---|---|
Interpro abstract (IPR009755): | This entry represents the C terminus (approximately 160 residues) of RMC1, which is a componement of the CCZ1-MON1 RAB7A guanine exchange factor (GEF) [ (PUBMED:29038162) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mic1