The domain within your query sequence starts at position 136 and ends at position 256; the E-value for the Microcephalin domain shown below is 2.4e-51.

ESFASGSHSSFGDSCGDQERKLGRSANEMTTVTCPSSPVLRASSFYGSASPNHLRQPRPQ
KAPDSPSKESINCQKDATGAVADSERKQAAGVSQGVPDEKLCLSPTMSIIEEHQVRLGPK
N

Microcephalin

 Microcephalin
PFAM accession number:PF12258
Interpro abstract (IPR029504):

Microcephalin is implicated in chromosome condensation and DNA damage induced cellular responses [ (PUBMED:15199523) (PUBMED:15220350) ]. It may play a role in neurogenesis and regulation of the size of the cerebral cortex in animals. It is a protein, which if expressed homozygously, causes the organism to have the condition microcephaly - a drastically reduced brain mass and volume [ (PUBMED:12046007) ]. Microcephalin is predicted to contain three BRCA1 C-terminal domains, the first of which is the probable microcephaly mutation site.

GO process:cerebral cortex development (GO:0021987)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Microcephalin