SMART: Pfam domain Miff

The domain within your query sequence starts at position 144 and ends at position 220; the E-value for the Miff domain shown below is 2.6e-28.

RRQNEIRYERPVLRGGSAAATSNPHHDNVRYGISNLDAAIEGASDDMTVVDAASLRRQII
KLNRRLQLLEEENKERA

Miff

PFAM accession number:	PF05644
Interpro abstract (IPR039433):	This entry represents a domain found in mitochondrial fission factor (Mff) and at the C terminus of FATE1. This domain has a predicted transmembrane segment preceded by a coiled-coil region. Despite their similarity in the C terminus, FATE1 lacks a Mff-similar N-terminal domain that is essential for interaction of Mff with the dynamin-related GTPase Drp1, which mediates mitochondrial fission. Instead, FATE1 is involved in the regulation of ER-mitochondria distance and Ca(2+) uptake by mitochondria [ (PUBMED:27402544) ].

PFAM accession number:

PF05644

Interpro abstract (IPR039433):

This entry represents a domain found in mitochondrial fission factor (Mff) and at the C terminus of FATE1. This domain has a predicted transmembrane segment preceded by a coiled-coil region. Despite their similarity in the C terminus, FATE1 lacks a Mff-similar N-terminal domain that is essential for interaction of Mff with the dynamin-related GTPase Drp1, which mediates mitochondrial fission. Instead, FATE1 is involved in the regulation of ER-mitochondria distance and Ca(2+) uptake by mitochondria [ (PUBMED:27402544) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Miff