The domain within your query sequence starts at position 6 and ends at position 120; the E-value for the Misat_Tub_SegII domain shown below is 2.1e-36.
REVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPGELCPDVLYRTGRTLHGQETYTP RLILMDLKGSLNTLKEEGNLYRDRQLEAAVAWQGKLSTHRDDAQPKNPNLQGLLS
Misat_Tub_SegII |
---|
PFAM accession number: | PF10644 |
---|---|
Interpro abstract (IPR019605): | The misato protein contains three distinct, conserved domains, segments I, II and III and is involved in the regulation of mitochondrial distribution and morphology [ (PUBMED:17349998) ]. This entry represents misato segment II. Segments I and III are common to tubulins ( IPR003008 ), but segment II aligns with myosin heavy chain sequences from Drosophila melanogaster (Fruit fly, P05661 ), rabbit ( P04460 ), and human. Segment II of misato is a major contributor to its greater length compared with the various tubulins. The most significant sequence similarities to this 54-amino acid region are from a motif found in the heavy chains of myosins from different organisms. A comparison of segment II with the vertebrate myosin heavy chains reveals that it shares homology with a myosin peptide in the hinge region linking the S2 and LMM domains. Segment II also contains heptad repeats which are characteristic of the myosin tail alpha-helical coiled-coils [ (PUBMED:9144213) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Misat_Tub_SegII