The domain within your query sequence starts at position 1 and ends at position 58; the E-value for the Mit_proteolip domain shown below is 4.5e-40.
MFQTLIQKVWVPMKPYYTQVYQEIWVGVGLMSLIVYKIRSADKRSKALKGPAPAHGHH
Mit_proteolip |
![]() |
---|
PFAM accession number: | PF08039 |
---|---|
Interpro abstract (IPR012574): | ATP5MPL (also known as MLQ) is a hydrophobic mitochondrial protein and a regulator of the mitochondrial ATP synthesis [ (PUBMED:24330338) ]. |
GO component: | mitochondrion (GO:0005739) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mit_proteolip