The domain within your query sequence starts at position 26 and ends at position 188; the E-value for the Mito_morph_reg domain shown below is 4e-80.
DCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVL AGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLP LHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKVYELY
Mito_morph_reg |
---|
PFAM accession number: | PF14972 |
---|---|
Interpro abstract (IPR026120): | TMEM11 (also called PMI in Drosophila) regulates mitochondrial morphogenesis via a mechanism which is independent of mitofusins and dynamin-related protein 1 [ (PUBMED:21274005) ]. |
GO process: | mitochondrion organization (GO:0007005) |
GO component: | integral component of mitochondrial inner membrane (GO:0031305) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mito_morph_reg