The domain within your query sequence starts at position 26 and ends at position 69; the E-value for the Mlf1IP domain shown below is 5.5e-7.

MRNMMRSFSEPLGRDLLSISDGRGRTHNRRERDDGEDSLTKTYL

Mlf1IP

Mlf1IP
PFAM accession number:PF10248
Interpro abstract (IPR019376):

Myeloid leukemia factor is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation [ (PUBMED:15861129) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mlf1IP