The domain within your query sequence starts at position 16 and ends at position 209; the E-value for the Mnd1 domain shown below is 2.4e-14.
ILRYLQEQNRPYSAQDVFGNLQKEHGLGKAAVVKALDQLAQEGKIKEKTYGKQKIYFADQ NQFDTVSDADLHGLDASIVALTAKVQSLQQSCRHMEAELKELTSALTTPEMQKEIQELKK ECAQYTERLKNIKAATNHVTPEEKEKVYRDRQKYCKEWRKRKRMTTELCDAILEGYPKSK KQFFEEVGIETDED
Mnd1 |
![]() |
---|
PFAM accession number: | PF03962 |
---|---|
Interpro abstract (IPR040453): | This HTH domain is found in Mnd1 from S. cerevisiae. The Mnd1 protein forms a complex with Hop2 to promote homologous chromosome pairing and meiotic double-strand break repair [ (PUBMED:11940665) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mnd1