SMART: Pfam domain Mob1

The domain within your query sequence starts at position 29 and ends at position 205; the E-value for the Mob1_phocein domain shown below is 3.4e-85.

LKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMS
AGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVA
KTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQ

Mob1_phocein

PFAM accession number:	PF03637
Interpro abstract (IPR005301):	The MOB kinase activator family includes MOB1, an essential Saccharomyces cerevisiae protein, identified from a two-hybrid screen, that binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Conditional alleles of MOB1 cause a late nuclear division arrest at restrictive temperature [ (PUBMED:9436989) ]. This family also includes the MOB-like protein phocein, an intracellular protein that interacts with striatin and may play a role in membrane trafficking [ (PUBMED:11872741) ].

PFAM accession number:

PF03637

Interpro abstract (IPR005301):

The MOB kinase activator family includes MOB1, an essential Saccharomyces cerevisiae protein, identified from a two-hybrid screen, that binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Conditional alleles of MOB1 cause a late nuclear division arrest at restrictive temperature [ (PUBMED:9436989) ]. This family also includes the MOB-like protein phocein, an intracellular protein that interacts with striatin and may play a role in membrane trafficking [ (PUBMED:11872741) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mob1_phocein