The domain within your query sequence starts at position 5 and ends at position 150; the E-value for the Mod_r domain shown below is 2.4e-39.

KDKTLQELEEMQNDPEAIARLALESPEVQDLQLEREMALATNRSLAEQNLEFQGPLEISR
SNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQIEGMKIEEESEAMAEKFLE
GEVPLETFLESFSSMRTLLHLRRVRV

Mod_r

• PFAM accession number: PF07200
• Interpro abstract (IPR009851):

  This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins. The N-terminal half of Mod(r) proteins is acidic, whereas the C-terminal half is basic [ (PUBMED:7651329) ], and both of these regions are represented in this family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mod_r