SMART: Pfam domain Mog1

The domain within your query sequence starts at position 7 and ends at position 145; the E-value for the Mog1 domain shown below is 1.3e-41.

CPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGEAAARY
HFEDVGRVQGARAVHVLSVQPLCLENLSLRGCCQDAWSLSGKQQVAKENQQVAKDVTLHQ
ALLRLPQYQTDLLLTFNQP

Mog1

PFAM accession number:	PF04603
Interpro abstract (IPR007681):	Segregation of nuclear and cytoplasmic processes facilitates regulation of many eukaryotic cellular functions such as gene expression and cell cycle progression. Trafficking through the nuclear pore requires a number of highly conserved soluble factors that escort macromolecular substrates into and out of the nucleus. The Mog1 protein has been shown to interact with RanGTP, which stimulates guanine nucleotide release, suggesting Mog1 regulates the nuclear transport functions of Ran [ (PUBMED:11733047) ]. The human homologue of Mog1 is thought to be alternatively spliced.

PFAM accession number:

PF04603

Interpro abstract (IPR007681):

Segregation of nuclear and cytoplasmic processes facilitates regulation of many eukaryotic cellular functions such as gene expression and cell cycle progression. Trafficking through the nuclear pore requires a number of highly conserved soluble factors that escort macromolecular substrates into and out of the nucleus. The Mog1 protein has been shown to interact with RanGTP, which stimulates guanine nucleotide release, suggesting Mog1 regulates the nuclear transport functions of Ran [ (PUBMED:11733047) ]. The human homologue of Mog1 is thought to be alternatively spliced.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mog1