The domain within your query sequence starts at position 56 and ends at position 114; the E-value for the Motilin_assoc domain shown below is 1.1e-36.
LHPEDRGQAEETEEELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPA
Motilin_assoc |
![]() |
---|
PFAM accession number: | PF04643 |
---|---|
Interpro abstract (IPR006737): | Motilin is a gastrointestinal regulatory polypeptide produced by motilin cells in the duodenal epithelium. It is released into the general circulation at about 100-min intervals during the inter-digestive state and is the most important factor in controlling the inter-digestive migrating contractions. Motilin also stimulates endogenous release of the endocrine pancreas [ (PUBMED:9210180) ]. This domain is also found in ghrelin, a growth hormone secretagogue synthesised by endocrine cells in the stomach. Ghrelin stimulates growth hormone secretagogue receptors in the pituitary. These receptors are distinct from the growth hormone-releasing hormone receptors, and thus provide a means of controlling pituitary growth hormone release by the gastrointestinal system [ (PUBMED:11306336) ]. This domain represents a peptide sequence that lies C-terminal to motilin/ghrelin ( IPR006738 ) on the respective precursor peptide. Its function is unknown. |
GO component: | extracellular region (GO:0005576) |
GO function: | hormone activity (GO:0005179) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Motilin_assoc