The domain within your query sequence starts at position 103 and ends at position 163; the E-value for the Mpv17_PMP22 domain shown below is 5.7e-18.
CFLPLVGILNGMSAQDNWAKLKRLWPAVQLANFYLVPLHYRLAVVQCVAIVWNSYLSWKA H
Mpv17_PMP22 |
![]() |
---|
PFAM accession number: | PF04117 |
---|---|
Interpro abstract (IPR007248): | The 22kDa peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the organelle membrane. PMP22 is synthesised on free cytosolic ribosomes and then directed to the peroxisome membrane by specific targeting information [ (PUBMED:11590176) ]. Mpv17 is a closely related peroxisomal protein involved in the development of early-onset glomerulosclerosis [ (PUBMED:11327696) ]. A member of this family found in Saccharomyces cerevisiae (Baker's yeast) is an integral membrane protein of the inner mitochondrial membrane and has been suggested to play a role in mitochondrial function during heat shock [ (PUBMED:15189984) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mpv17_PMP22